PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G142300.1.p
Common NameSb03g012310, SORBIDRAFT_03g012310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 307aa    MW: 33694.2 Da    PI: 6.5043
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G142300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-162572148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg+WT +Ed ll+ +v+ +G g+W+  ar  g++Rt+k+c++rw++yl
  Sobic.003G142300.1.p 25 RGPWTVDEDALLAGYVAAHGEGRWNELARAAGLRRTGKSCRLRWLNYL 72
                          89********************************************97 PP

2Myb_DNA-binding52.51.2e-1678121146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rg +T+ E++l++d+++++G++ W++Ia++++ gRt++++k++w++
  Sobic.003G142300.1.p  78 RGDFTPREQLLILDLHARWGNR-WSKIAAHLP-GRTDNEVKNYWRT 121
                           899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.3792072IPR017930Myb domain
SMARTSM007174.1E-132474IPR001005SANT/Myb domain
SuperFamilySSF466895.99E-3024119IPR009057Homeodomain-like
PfamPF002495.1E-152572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-212679IPR009057Homeodomain-like
CDDcd001672.15E-92772No hitNo description
PROSITE profilePS5129422.20573127IPR017930Myb domain
SMARTSM007175.8E-1577125IPR001005SANT/Myb domain
PfamPF002491.9E-1578121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2380126IPR009057Homeodomain-like
CDDcd001674.00E-1181121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MDALWKQGSS SLCDWPAAEA ELLRRGPWTV DEDALLAGYV AAHGEGRWNE LARAAGLRRT  60
GKSCRLRWLN YLRPGVRRGD FTPREQLLIL DLHARWGNRW SKIAAHLPGR TDNEVKNYWR  120
TRVQKHAKQL GCDVGSHRFH DAIRNLWMPR LIERIHADET SATAAAAAAA ADNVSRYYSS  180
TSPSHELSSS QPAAAYGNAV PVGNCARAPS PDASSSVTGS SWSREASPPS QLQSSSCSTM  240
AGCSTSTDQC HNNGCSSATS VVDMFDESWS ELLARANHDD TEFGFGLGET GDNWWSLEDI  300
WEQPLY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-2411191120MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.199750.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455504.10.0hypothetical protein SORBIDRAFT_03g012310
TrEMBLC5XI400.0C5XI40_SORBI; Putative uncharacterized protein Sb03g012310
STRINGSb03g012310.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Representative plantOGRP1422434
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.12e-74myb domain protein 112